PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011069612.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 297aa    MW: 32901.2 Da    PI: 4.2397
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011069612.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.21.5e-374196661
          zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     +cprC stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvP+Ggg+rk++++
  XP_011069612.1 41 PNCPRCASTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPIGGGCRKSRRA 96
                    58**************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-291795IPR003851Zinc finger, Dof-type
PfamPF027014.0E-324195IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5184195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MFTSTATTSE YSILECPPTI RPLVMDRTTS KWKYNNIEIA PNCPRCASTN TKFCYYNNYS  60
LSQPRYFCKG CRRYWTKGGS LRNVPIGGGC RKSRRARATK QVGGTNCTAP ALSPVCMGSS  120
SNESESGLDI DLAAVFAKYV NQNGENEESS CSPGASSGSS DHNVQASPLD LDGQMEDMAM  180
FDQYQKGAVD LISGGDDQIQ QVIPHEFSMH EDHDQFNGQD FVYQDYNAFD QVQQGIALGD  240
ELSADMLWSE GTDLPGFEDQ QSMMQLQDSF GFITNDEQLR FSANLVSDNW GSFDLYA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069612.10.0PREDICTED: dof zinc finger protein DOF1.2
SwissprotP683493e-41DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A022PT431e-76A0A022PT43_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.16e-42Dof family protein